PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00038742001
Common NameGSBRNA2T00038742001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 486aa    MW: 55314.9 Da    PI: 7.0258
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00038742001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.73.6e-3074128155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+rlrW+++LH++Fv+ave+LGG++kAtPk+++++m+v+g++l+hvkSHLQk+Rl
  GSBRNA2T00038742001  74 KARLRWSSDLHACFVKAVEKLGGPDKATPKAVKDTMEVEGIALHHVKSHLQKFRL 128
                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-2671128IPR009057Homeodomain-like
SuperFamilySSF466898.78E-1373128IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-2574129IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MSSQEQKKKE KGKEIVTSEE NPTTSEVSMY FSEQGIAALL EANKKDNAEK VGTQQKKSSS  60
SKIKPCIFYT SDEKARLRWS SDLHACFVKA VEKLGGPDKA TPKAVKDTME VEGIALHHVK  120
SHLQKFRLGR CNIRDETDQY HKRYRTGRRF FKAHAASNSP RPQVNIRPKV MGDVKPKKAK  180
EDHGSLYMRI EHDLNLQRCR EAERMQMAFE IENNRKMLEA QYIQASKAPS ITSQHRNYIS  240
TTTQRPSSQV LDQWLADHYS GRQTSDSQQP TTMIPQTTTC LPMWEFPQET KNTFSMYDPQ  300
HVNTSTQEKR QFNKSLNYNM TQGFINPYVT TEPQSMPGSS TVTTQPELQL NDDCLIHDLY  360
RNPSFLPTSV PQTVDSLHQV ISNITSPLST APQPIQTYAP NHTYNYPEYN TLERVKAQLS  420
ALQYSSTSRI QATPFCETNL SSSVTRDDEE DPVDMYIDWG KYEEVDIDEL DPVEALLALG  480
FSVSP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00038742001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009102404.10.0PREDICTED: uncharacterized protein LOC103828546
TrEMBLA0A078GMS60.0A0A078GMS6_BRANA; BnaA07g04750D protein
STRINGBra015134.1-P1e-112(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134061520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G06020.15e-55G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]